RESUMO Introdução O treino de esqui apresenta alta habilidade dos atletas e forte demanda no condicionamento físico da articulação do joelho, que é frequentemente lesionada. Objetivo Estudar as lesões esportivas da articulação do joelho no treino de esqui e explorar suas medidas preventivas. Métodos O método de entrevista foi usado com instrutores, entusiastas e esportistas de esqui por questionário com projetação e distribuição de tópicos relacionados à ocorrência das lesões. Os fatores de lesão esportiva são discutidos interna e externamente. Medidas preventivas e equipamentos de proteção para lesões esportivas no joelho são apresentados. Resultados Atualmente, a proporção de lesões esportivas graves na articulação do joelho é relativamente alta e problemas como colisão são os fatores de lesão mais comuns, existindo diferenças entre atletas do sexo masculino e feminino. Entre as causas de lesão, o fator técnico de maior pontuação para lesão foi “desvio de movimentos técnicos”, e as medidas preventivas de maior pontuação foram “treinamento de força para partes vulneráveis” e “preparação suficiente para as atividades”. Conclusão Os treinadores devem fornecer programas de treino eficazes de acordo com a situação real dos atletas, atentarem-se ao monitoramento do ambiente de esqui e indicar os equipamentos de proteção adequados ao esporte. Nível de evidência II; Estudos terapêuticos - investigação dos resultados do tratamento.

ABSTRACT Introduction Ski training presents the high ability of athletes and strong demand on the physical conditioning of the knee joint, which is frequently injured. Objective Study the sports injuries of the knee joint in ski training and explore its preventive measures. Methods The interview method was used with ski instructors, enthusiasts, and athletes by questionnaire with design and distribution of topics related to the occurrence of injuries. Sport injury factors are discussed internally and externally. Preventive measures and protective equipment for knee sports injuries are presented. Results Currently, the proportion of serious sports injuries to the knee joint is relatively high, and problems such as collision are the most common injury factors, and differences exist between male and female athletes. Among the causes of injury, the highest-scoring technical factor for injury was “deviation from technical movements”, and the highest-scoring preventive measures were “strength training for vulnerable parts” and “sufficient preparation for activities”. Conclusion The instructors should provide effective training programs according to the actual situation of the athletes, pay attention to monitoring the skiing environment, and recommend the appropriate protective equipment for the sport. Level of evidence II; Therapeutic studies - investigation of treatment results.

RESUMEN Introducción El entrenamiento de esquí presenta una alta capacidad de los deportistas y una fuerte exigencia en el acondicionamiento físico de la articulación de la rodilla, que se lesiona con frecuencia. Objetivo Estudiar las lesiones deportivas de la articulación de la rodilla en el entrenamiento de esquí y explorar sus medidas preventivas. Métodos Se utilizó el método de la entrevista con instructores de esquí, aficionados y deportistas mediante un cuestionario con diseño y distribución de temas relacionados con la ocurrencia de las lesiones. Los factores de las lesiones deportivas se discuten interna y externamente. Se presentan las medidas preventivas y los equipos de protección para las lesiones deportivas de rodilla. Resultados En la actualidad, la proporción de lesiones deportivas graves en la articulación de la rodilla es relativamente alta y problemas como la colisión son los factores de lesión más comunes, y existen diferencias entre los deportistas masculinos y femeninos. Entre las causas de las lesiones, el factor técnico con mayor puntuación fue la “desviación de los movimientos técnicos”, y las medidas preventivas con mayor puntuación fueron el “entrenamiento de fuerza de las partes vulnerables” y la “preparación suficiente para las actividades”. Conclusión Los entrenadores deben proporcionar programas de entrenamiento eficaces en función de la situación real de los deportistas, prestar atención al seguimiento del entorno de esquí e indicar el equipo de protección adecuado para el deporte. Nivel de evidencia II; Estudios terapéuticos - investigación de los resultados del tratamiento.

Abstract Objective: To investigate the impact of recombinant human interferon α1b (rhIFNα1b) treatment in infants hospitalized with lower respiratory tract infections on subsequent wheezing. Methods: The clinical data of infants (n = 540) with viral pneumonia, wheezy bronchitis, or bronchiolitis hospitalized in 19 Chinese hospitals from June 2009 to June 2015 were retrospectively analyzed. The parameters relevant to wheezing episodes within the last year were collected by telephone and questionnaires. The rhIFNα1b treatment group (n = 253) and control group (n = 287) were compared in terms of wheezing episodes within the last year. Moreover, the wheezing group (95 cases) and non-wheezing group (445 cases) were compared. Results: Out of 540 cases, 95 (17.6%) experienced wheezing episodes, 13.8% (35/253) cases treated with rhIFNα1b, and 20.9% (60/287) cases without rhIFNα1b experienced wheezing episodes within the last year. The rhIFNα1b treatment significantly improved wheezing episodes within the last year, compared with the control peers (p = 0.031). Single-factor regression showed statistically significant differences between the wheezing and non-wheezing groups in terms of age, rhIFNα1b use, childhood and family history of allergy, housing situation, and feeding history (p < 0.05). Binary logistic regression showed a childhood history of allergy (OR = 2.14, p = 0.004), no rhIFNα1b use (OR = 1.70, p = 0.028), and living in a crowded house (OR = 1.92, p = 0.012) might be risk factors of subsequent wheezing. Accordingly, breastfeeding (OR = 0.44, p = 0.008) and hospitalization age of 1-year-old (OR = 0.58, p = 0.024) were protective factors. Conclusions: Early use of rhIFNα1b in infants hospitalized with lower respiratory tract infections and breastfeeding could prevent subsequent wheezing. Living in a crowded house could promote subsequent wheezing.

RESUMO Introdução: As lesões no esporte são uma razão importante para interferir no treinamento esportivo e no exercício físico, já que não apenas levam a dor desnecessária do corpo lesado, mas também levam a emoções negativas em atletas. Objetivo: Estudar as características de lesões esportivas de atletas de ginástica aeróbica de alto nível competitivo na China. Métodos: Dados da literatura, questionário de sondagem, entrevistas especializadas, observação de campo, estatísticas matemáticas e acompanhamento fisioterapêutico foram usados. Resultados: Pulsos, tornozelos, cintura e joelhos são as partes lesadas com maior frequência nas atletas de ginástica aeróbica de alto nível competitivo na China. O tipo mais comum é a lesão aguda, porém a lesão crônica (48,18%) não pode ser ignorada. Noventa por cento de atletas de ginástica aeróbica de alto nível competitivo na ativa treinam com lesões, e 10% param de treinar completamente devido às lesões. Conclusões: Atletas devem ficar atentos a suas reservas fiscais e fortalecer seu treino físico. Devem também ficar atentos a auto supervisão, ao seu estado emocional e controlar a quantidade exercícios que praticam. Nível de evidência II; Estudos terapêuticos – investigação de resultados de tratamento.

ABSTRACT Introduction: Sports injury is an important reason to interfere with sports training and physical exercise since it will not only bring unnecessary pain to the injured body, but also bring out negative emotions in athletes. Objective: To study the sports injury characteristics of high level competitive aerobics athletes in China. Methods: Literature data, questionnaire survey, expert interviews, field observation, mathematical statistics and physiotherapy tracking were used. Results: Wrists, ankles, waist and knees were the most frequently injured parts in high level competitive aerobics athletes in China. The main type of injury was acute injury, but chronic injury (48.18%) could not be ignored. Ninety percent of active high-level competitive aerobics athletes train with injuries, and 10 percent of them completely stop training because of injuries. Conclusions: Athletes should pay attention to their physical reserve and strengthen physical training. They must also be attentive to self-supervision, their own subjective feelings, and control the amount of exercise done. Level of evidence II; Therapeutic studies - investigation of treatment results.

RESUMEN Introducción: Las lesiones en el deporte son una razón importante para interferir en el entrenamiento deportivo y en el ejercicio físico, ya que no solo llevan al dolor desnecesario del cuerpo lesionado, sino que llevan a emociones negativas en atletas. Objetivo: Estudiar las características de lesiones deportivas de atletas de gimnasia aeróbica de alto nivel competitivo en China. Métodos: Se utilizaron datos de la literatura, encuestas de sondeo, entrevistas especializadas, observación de campo, estadísticas matemáticas y acompañamiento fisioterapéutico. Resultados: Muñecas, tobillos, cintura y rodillas son las partes lesionadas con mayor frecuencia en las atletas de gimnasia aeróbica de alto nivel competitivo en China. El tipo más común es la lesión aguda, pero la lesión crónica (48,18%) no puede ignorarse. Noventa por ciento de atletas de gimnasia aeróbica de alto nivel competitivo en China entrenan con lesiones, y 10% paran de entrenar completamiento debido a las lesiones. Conclusiones: Atletas deben atentarse a sus reservas fiscales y fortalecer su entrenamiento físico. Deben también atentarse a la autosupervisión, a su estado emocional y controlar la cantidad de ejercicios que practican. Nivel de evidencia II; Estudios terapéuticos – investigación de resultados de tratamiento.

RESUMO Introdução: A junta do joelho é uma junta complexa e importante para o corpo humano. Tem um papel ativo na manutenção do equilíbrio postural do corpo humano nos esportes, permitindo que se suporte cargas maiores e que se realize vários movimentos técnicos complexos. Objetivo: Investigar a estabilidade e influência da cinemática no treino para reabilitação da junta do joelho. Métodos: Um total de 80 pacientes com lesão de ligamento cruzado anterior que receberam tratamento no Hospital do Povo da Província de Henan foram selecionados e divididos em grupo de controle e grupo de observação, de acordo com o método de tabela numérica aleatória, com 40 casos em cada grupo. Resultados: Seis meses após a cirurgia, o torque de pico (TP), a proporção torque de pico-peso corporal (TP-PC), trabalho total (TT), escore Lysholm e escore Tegner, e a circunferência do joelho dos dois grupos melhoraram significativamente em relação à antes da cirurgia (P <0.01). O grau de recuperação foi maior no grupo de observação: comparado com o grupo de controle, a diferença é estatisticamente significativa (P <0.01). Conclusões: A reabilitação com exercícios profissionais definitivamente tem efeito em pacientes após a reconstrução do ligamento cruzado anterior, pois pode aumentar a força muscular de quadríceps e tendões, melhorar a função da junta do joelho e levar a sua recuperação. Nível de evidência II; estudos terapêuticos – investigação de resultados de tratamento.

ABSTRACT Introduction: The knee joint is a complex and important joint in the human body. It plays an active role in maintaining posture balance of the human body in sports, allowing one to bear a larger load and complete various complex technical movements. Objective: To investigate the stability and influence of kinemechanics in knee joint rehabilitation training. Methods: A total of 80 patients with anterior cruciate ligament injury who received treatment in Henan Provincial People's Hospital were selected and divided into control group and observation group according to the random number table method, with 40 cases in each group. Results: Six months after surgery, the peak torque (PT), peak torque to body weight ratio (PT/BWT), total work (TWT), Lysholm score and Tegner score, and knee circumference of the two groups were significantly improved compared with those before surgery (P <0.01). The degree of improvement was greater in the observation group:compared with the control group, the difference was highly statistically significant (P<0.01). Conclusions: Professional exercise rehabilitation has a definite effect on patients after anterior cruciate ligament reconstruction. It can significantly improve the muscle strength of quadriceps and hamstring, improve the function of knee joint and promote its recovery. Level of evidence II; Therapeutic studies - investigation of treatment results.

RESUMEN Introducción: La articulación de la rodilla es compleja e importante para el cuerpo humano. Tiene un papel activo en la manutención del equilibrio postural del cuerpo humano en los deportes, permitiendo que se soporte cargas mayores y que se realice varios movimientos técnicos complejos. Objetivo: Investigar la estabilidad e influencia de la cinemática en el entrenamiento para rehabilitación de la articulación de la rodilla. Métodos: Se seleccionó un total de 80 pacientes con lesión de ligamento cruzado anterior que recibieron tratamiento en el Hospital del Pueblo de la Provincia de Henan y se los dividió en grupo de control y grupo de observación, de acuerdo con el método de tabla de números aleatorios, con 40 casos en cada grupo. Resultados: Seis meses tras la cirugía, el torque de pico (TP), la proporción torque de pico-peso corporal (TP-PC), trabajo total (TT), puntuación Lysholm y puntuación Tegner, y la circunferencia de la rodilla de los dos grupos mejoraron significativamente en relación a antes de la cirugía (P<0.01). El grado de recuperación fue mayor en el grupo de observación: comparado con el grupo de control, la diferencia es estadísticamente significativa (P<0.01). Conclusiones: La rehabilitación con ejercicios profesionales definitivamente tiene efecto en pacientes tras la reconstrucción del ligamento cruzado anterior, pues puede aumentar la fuerza muscular de cuádriceps y tendones, mejorar la función de la articulación de la rodilla y llevar a su recuperación. Nivel de evidencia II; Estudios terapéuticos – investigación de resultados de tratamiento.

Abstract Background Termicin is an antimicrobial peptide with six cysteines forming three disulfide bridges that was firstly isolated from the salivary glands and hemocytes of the termite Pseudacanthotermes spiniger. In contrast to many broad-spectrum antimicrobial peptides, termicin is most active against filamentous fungi. Although more than one hundred complementary DNAs (cDNAs) encoding termicin-like peptides have been reported to date, all these termicin-like peptides were obtained from Isoptera insects. Methods The cDNA was cloned by combination of cDNA library construction kit and DNA sequencing. The polypeptide was purified by gel filtration and reversed-phase high performance liquid chromatography (RP-HPLC). Its amino acid sequence was determined by Edman degradation and mass spectrometry. Antimicrobial activity was tested against several bacterial and fungal strains. The minimum inhibitory concentration (MIC) was determined by microdilution tests. Results A novel termicin-like peptide with primary structure ACDFQQCWVTCQRQYSINFISARCNGDSCVCTFRT was purified from extracts of the cockroach Eupolyphaga sinensis (Insecta: Blattodea). The cDNA encoding Es-termicin was cloned by cDNA library screening. This cDNA encoded a 60 amino acid precursor which included a 25 amino acid signal peptide. Amino acid sequence deduced from the cDNA matched well with the result of protein Edman degradation. Susceptibility test indicated that Es-termicin showed strong ability to kill fungi with a MIC of 25 μg/mL against Candida albicans ATCC 90028. It only showed limited potency to affect the growth of Gram-positive bacteria with a MIC of 200 μg/mL against Enterococcus faecalis ATCC 29212. It was inactive against gram-negative bacteria at the highest concentration tested (400 μg/mL). Es-termicin showed high sequence similarity with termicins from many species of termites (Insecta: Isoptera). Conclusions This is the first report of a termicin-like peptide isolated from E. sinensis that belongs to the insect order Blattodea. Our results demonstrate the diversity of termicin-like peptides, as well as antimicrobial peptides in insects.