Proteomic profile of <i>Piper tuberculatum</i> (Piperaceae)

Cotinguiba, F.; López, S. N.; Budzinski, I. G. F.; Labate, C. A.; Kato, M. J.; Furlan, M.

doi:10.1590/1519-6984.07816

Acessibilidade / Reportar erro

Brasil

Brazilian Journal of Biology

Español English

Brasil

Español English

sumário « anterior atual seguinte »

Sumário

Original Article • Braz. J. Biol. 78 (1) • Feb 2018 • https://doi.org/10.1590/1519-6984.07816 copy

Proteomic profile of Piper tuberculatum (Piperaceae)

Perfil proteômico e metabólico de Piper tuberculatum (Piperaceae)

Authorship SCIMAGO INSTITUTIONS RANKINGS

Abstract

Piper tuberculatum (Piperaceae) is a species that accumulates especially amides as secondary metabolites and several biological activities was previously reported. In this article, we report a proteomic study of P. tuberculatum. Bidimensional electrophoresis (2D SDS-PAGE) and mass spectrometry (ESI-Q-TOF) were used in this study. Over a hundred spots and various peptides were identified in this species and the putative functions of these peptides related to defense mechanism as biotic and abiotic stress were assigned. The information presented extend the range of molecular information of P. tuberculatum.

Keywords:
Piperaceae; amidas; Piper tuberculatum; proteomics; 2D-SDS-PAGE

Spot	Protein Score	Total Ion Score	Peptide Sequences	ID (NCBI)	Proteins	Species	Mr (kDa) and pI (Iit.)	Mr (kDa) and pI (exp.)	Coverage (%)	Access	Biological Process
*P. tuberculatum (leaves)*
6	63	63	GGLDFTKDDENVNSQPFMR	gi\|15148424	RuBisCO	Cardiandra alternifolia	52416/ 6.08	71480/ 6.32	6	Q0INY7	1.1.1.2
7	58	58	DTDILAAFR	gi\|8096541	RuBisCO (large subunit)	Solanum lycopersicum	53398/ 6.55	54825/ 3.89	6	Q0INY7	1.1.1.2
8	177	117	DITLGFVDLLRDDFIEQDR	gi\|169563	RuBisCO (large subunit)	Solanum tuberosum	53371/ 6.19	51615/ 4.97	11	Q0INY7	1.1.1.2
11	111	79	VALEACVKAR	gi\|169563	RuBisCO (large subunit)	Solanum tuberosum	53371/ 6.19	52677/ 6.65	11	Q0INY7	1.1.1.2
12B	141	78	VALEACVKAR	gi\|349144	RuBisCO (large subunit)	Solanum lycopersicum	53398/ 6.55	52744/ 6.92	12	Q0INY7	1.1.1.2
13	55	55	VALEACVKAR	gi\|1352794	RuBisCO (large subunit)	Harpagophytum grandidieri	52139/ 6.23	46612/ 5.33	6	Q0INY7	1.1.1.2
17	279	96	IVDSFPGQSIDFFGALR	gi\|10720247	RuBisCO (large subunit)	Oryza sativa	50897/ 8.61	43219/ 5.74	12	Q0INY7	1.1.1.2
18	131	105	IVDSFPGQSIDFFGALR	gi\|10720247	RuBisCO (large subunit)	Oryza sativa	48055/ 5.85	43226/ 5.91	6	Q0INY7	1.1.1.2
9	341	124	IFNVLGEPVDNLGPVDTR	gi\|52082860	ATPase (subunit β)	Piper hispidum	50620/ 5.04	51980/ 5.26	20	P11574	1.1.3
30	193	124	VAVLGAAGGIGQPLALLMK	gi\|126896	malate dehydrogenase	Citrullus lanatus	36406/ 8.88	36711/ 7.40	10	P17606	1.1.3
29	60	60	ILFIGGTGYIGK	gi\|1708422	isoflavone reductase	Solanum tuberosum	33831/ 6.16	32566/ 5.92	3	Q00016	1.2.8
14	191	135	AAQDIALAELAPTHPIR	gi\|1345588	Protein 14-3-3-like	Saccharum (hybrid cultivar CP65-357)	28978/ 4.79	46447/ 5.52	22	Q96299	2.1.2
37	185	135	AAQDIALAELAPTHPIR	gi\|1345588	Protein 14-3-3-like	Sugar cane	28978/ 4.79	28619/ 5.81	16	Q96299	2.1.2
38	50	50	ADVDNKESVGK	gi\|1345588	RNA polymerase IV (second large unit)	Rhododendron macrophyllum	116144/ 8.98	27455/ 5.71	1	Q9LK40	2.1.2
27	39	39	ELGIGIVPYSPIGR	gi\|78708648	Protein induction auxin	Oryza sativa	37905/ 5.81	37698/ 5.76	4	Q9ZTX8	2.2.3
28	152	72	SGPLQPGVDIIEGPVK	gi\|132270	Rubber elongation factor	Hevea brasiliensis	14713/ 5.04	36441/ 6.10	42	P15252	2.2.3
46	82	58	SGPLQPGVDIIEGPVK	gi\|132270	Rubber elongation factor	Hevea brasiliensis	14713/ 5.04	18613/	19	P15252	2.2.3
4	41	41	VIDEIRER	gi\|3763925	Ligation protein/ clathrin	Arabidopsis thaliana	30781/ 9.30	60320/ 5.1	2	Q8VY07	3.3
3	224	111	SLDIERPTYTNLNR	gi\|6094431	α-3-tubulin	Hordeum vulgare	50193/ 4.95	62256/ 4.90	11	P08841	4.3
45	54	54	IWHHTFYNELR	gi\|3219759	Actin	Glycine max	41796/ 5.23	21742/ 5.32	2	Q96292	4.3
44	45	45	LSGEVDANKAEVK	gi\|159487461	Protein 2 - chromosome structural maintenance	Chlamydomonas reinhardtii	128165/ 6.66	23389/ 4.92	1	Q9C5Y4	4.5
47	222	119	LPTDETLVAQIK	gi\|162458009	Factor 5A - Initiation of eukaryotic translation	Zea mays	17714/ 5.61	19100/ 4.63	34	Q76E23	5.3.3
1	97	45	AVVTVPAYFNDSQR	gi\|24638460	heat shock protein 70	Cucumis sativus	75480/ 5.15	76250/ 4.81	4	P22953	5.3.5
5	61	61	GVEELADAVR		GroEL-like chaperone	Vitis vinifera	61673/ 5.85	61293/ 5.52	1	Q8L7B5	5.3.5
10	441	130	KIEDAVDSAISWLDSNQLAEVDEFEDK	gi\|242054931	Hypothetical protein SORBIDRAFT_03g039360	Sorghum bicolor	71261/ 5.10	52456/ 6.15	27		6.2
P. tuberculatum (fruits)
S7	137	83	ELAAQPDVDGFLVGGASLKPEFIDIINAATVK	gi\|195605636	Triose phosphate isomerase	Zea mays	27278/ 5.53	35125/ 5.32	28%	P48491	1.1.2
S2	190	91	TVLIMELINNIAK	gi\|6687280	ATP synthase (β subunit)	Codonopsis pilosula	53628/ 5.07	57186/ 5.10	15%	P11574	1.1.3
S4	46	46	LKLELAQFAELQAFAQFASALDK	gi\|51556908	ATP synthase (α subunit)	Elymus sibiricus	55549/ 6.03	55566/ 6.12	4%	P11574	1.1.3
S6	404	148	DNLTLWTSDISEDPAEEIR	gi\|195635799	Protein 14-3-3-like (GF14-6)	Zea mays	30985/ 4.84	42255/ 7.82	20%	Q96299	2.1.2
S9	205	114	SSITPGTVLILLAGR	gi\|195605226	60S ribosomal protein L6	Zea mays	24273/ 10.14	30158/ 5.42	11%	Q9C9C5	4.4.2
S10	127	127	AMVPVAEVNVPVVGGHAGITILPLFSQATPK	gi\|224061310	Not identified	Populus trichocarpa	35704/ 8.53	35732/ 7.38	9%	-	6.3

Instituto Internacional de Ecologia R. Bento Carlos, 750, 13560-660 São Carlos SP - Brasil, Tel. e Fax: (55 16) 3362-5400 - São Carlos - SP - Brazil
E-mail: bjb@bjb.com.br

Acompanhe os números deste periódico no seu leitor de RSS

[1] *e-mail: fernando@nppn.ufrj.br