SciELO - Scientific Electronic Library Online

 
vol.13 issue1Scorpion envenomation symptoms in pregnant womenFrequency of rhabdiasid nematodes in wild Crotalus durissus terrificus (serpentes, viperidae) from Botucatu region, São Paulo state, Brazil author indexsubject indexarticles search
Home Pagealphabetic serial listing  

Services on Demand

Article

Indicators

Related links

Share


Journal of Venomous Animals and Toxins including Tropical Diseases

On-line version ISSN 1678-9199

J. Venom. Anim. Toxins incl. Trop. Dis vol.13 no.1 Botucatu  2007

http://dx.doi.org/10.1590/S1678-91992007000100008 

ORIGINAL PAPER

 

Purification and n-terminal sequencing of two presynaptic neurotoxic PLA2, neuwieditoxin-I and neuwieditoxin-II, from Bothrops neuwiedi pauloensis (jararaca pintada) venom

 

 

Borja-Oliveira C. R.I; Kassab B. H.II; Soares A. M.III; Toyama M. H.II; Giglio J. R.IV; Marangoni S.II; Re L.V; Rodrigues-Simioni L.I

IDepartment of Pharmacology, School of Medical Sciences, State University of Campinas, UNICAMP, Campinas, São Paulo State, Brazil
IIDepartment of Biochemistry, Institute of Biology, State University of Campinas, UNICAMP, Campinas, São Paulo State, Brazil
IIIDepartment of Clinical, Toxicological and Bromatological Analyses, School of Pharmaceutical Sciences, FCFRP, University of São Paulo, USP, Ribeirão Preto, São Paulo State, Brazil
IVDepartment of Biochemistry and Immunology, School of Medicine, University of São Paulo, USP, Ribeirão Preto, São Paulo State, Brazil
VInstitute of Experimental and Clinical Sciences, Laboratory of Pharmacology, University of Ancona, Ancona, Italy

Correspondence to

 

 


ABSTRACT

Two presynaptic phospholipases A2 (PLA2), neuwieditoxin-I (NeuTX-I) and neuwieditoxin-II (NeuTX-II), were isolated from the venom of Bothrops neuwiedi pauloensis (BNP). The venom was fractionated using molecular exclusion HPLC (Protein-Pak 300SW column), followed by reverse phase HPLC (µBondapak C18 column). Tricine-SDS-PAGE in the presence or absence of dithiothreitol showed that NeuTX-I and NeuTX-II had a molecular mass of approximately 14 kDa and 28kDa, respectively. At 10µg/ml, both toxins produced complete neuromuscular blockade in indirectly stimulated chick biventer cervicis isolated preparation without inhibiting the response to acetylcholine, but NeuTX-II reduced the response to KCl by 67.0±8.0% (n=3; p<0.05). NeuTX-I and NeuTX-II are probably responsible for the presynaptic neurotoxicity of BNP venom in vitro. In fact, using loose patch clamp technique for mouse phrenic nerve-diaphragm preparation, NeuTX-I produced a calcium-dependent blockade of acetylcholine release and caused appearance of giant miniature end-plate potentials (mepps), indicating a pure presynaptic action. The N-terminal sequence of NeuTX-I was DLVQFGQMILKVAGRSLPKSYGAYGCYCGWGGRGK (71% homology with bothropstoxin-II and 54% homology with caudoxin) and that of NeuTX-II was SLFEFAKMILEETKRLPFPYYGAYGCYCGWGGQGQPKDAT (92% homology with Basp-III and 62% homology with crotoxin PLA2). The fact that NeuTX-I has Q-4 (Gln-4) and both toxins have F-5 (Phe-5) and Y-28 (Tyr-28) strongly suggests that NeuTX-I and NeuTX-II are Asp49 PLA2.

Key words: chick biventer cervicis, loose patch clamp, nerve-muscle preparation, neuromuscular junction, neurotoxicity, PLA2 neurotoxin, presynaptic action, Bothrops neuwiedi pauloensis, Neuwieditoxin-I, Neuwieditoxin-II.


 

 

INTRODUCTION

Out of the four genera of venomous snakes in Brazil (Bothrops, Crotalus, Lachesis and Micrurus), only Crotalus and Micrurus cause failure of the neuromuscular junction, producing peripheral muscular weakness. However, the main complications in lethal envenomations by Bothrops species are acute renal failure, shock and sepsis (6, 41). Respiratory failure is also observed sometimes but the mechanism is not well understood. Since Bothrops venoms produce no signs of neurotoxicity after snakebite, respiratory failure has been related to pulmonary edema (41).

The neuromuscular actions of various Bothrops venoms have been extensively investigated in recent years. Cogo et al. (9) reported the neurotoxicity of Bothrops insularis venom on mice and chicks and on mouse phrenic nerve-diaphragm (MPND) and chick biventer cervicis (CBC) isolated preparations. After a lethal intramuscular (i.m.) dose of venom, chicks showed flaccidity followed by head-drop, dyspnea, apnea, convulsions and death. The venom produced irreversible blockade of MPND and CBC, and increased the frequency of mepps in mouse diaphragm. Subsequently, a neurotoxic presynaptic PLA2 fraction, which blocked indirectly-evoked twitches in CBC but did not affect the responses to acetylcholine (ACh) and KCl, was isolated from this venom (10).

Zamuner et al. (53) reported that B. neuwiedi venom caused head-drop, loss of balance and respiratory failure in chicks, after an i.m. dose of 0.55 mg/kg. The venom also inhibited the twitch-tension responses in CBC preparations, but did not decrease the contractures to exogenous ACh or KCl, thus suggesting a presynaptic action. Borja-Oliveira et al. (5) subsequently investigated the neurotoxicity of several lots of B. neuwiedi venoms on CBC and observed that not all B. neuwiedi venoms exhibited neurotoxicity. Furthermore, analysis of the neurotoxic action of a sample of B. neuwiedi pauloensis (BNP) venom on CBC showed that the presynaptic action of the venom was temperature-dependent (4). More recently, we have observed that the presynaptic neurotoxicity of BNP on MPND is Ca2+-dependent and accompanied by a pronounced increase in the frequency of mepps and the presence of giant mepps (12).

PLA2 (E.C. 3.1.14) are Ca2+-dependent enzymes that catalyze the hydrolysis of phospholipids at position sn-2 (51). Snake venom PLA2 occurs in groups I (Elapidae and Hydrophidae) and II (Viperidae). Group II contains the catalytically-active Asp49 PLA2, as well as the Lys49 isoforms. The latter type of proteins are considered PLA2 homologues since they are probably devoid of (or may have very low) catalytic activity. In addition to their enzymatic activity, venom PLA2 may have other actions, such as neurotoxicity and myotoxicity (25).

In the present work, two presynaptic neurotoxic PLA2, named neuwieditoxin-I (NeuTX-I) and neuwieditoxin-II (NeuTX-II), were isolated from BNP venom and partially sequenced. This is the first time to our knowledge that a pure presynaptically active neurotoxin such as NeuTX-I has been isolated from botropic venom and partially sequenced.

 

MATERIALS AND METHODS

Reagents and venom

Acetylcholine chloride, solvents (HPLC grade) and other reagents were obtained from Sigma and Aldrich Chemical Company (St Louis, MO, USA). Bothrops neuwiedi pauloensis venom, collected in the state of São Paulo, was provided by Butantan Institute (São Paulo, São Paulo State, Brazil). The venom was obtained from adult specimens, and was desiccated and stored at 2-4°C.

Purification of Neuwieditoxins I and II

Molecular exclusion HPLC: Bothrops neuwiedi pauloensis venom (25mg) was loaded onto a Protein-Pak 300SW (Waters, Milford, MA, USA) column (0.78cm X 30cm) and eluted with 0.25M ammonium bicarbonate, pH 7.9, at a flow rate of 0.3ml/min. The elution profile was monitored at 280nm using a Waters 490 programmable multiwavelength detector (Waters, Milford, MA, USA); fractions were collected using a Foxy 200 automatic fraction collector (Isco, Inc., Lincoln, NE, USA). The chromatographic runs were recorded on a 746 data module dual channel recorder (Waters, Milford, MA, USA).

Reverse-phase HPLC: Lyophilized fractions from molecular exclusion HPLC were screened for neuromuscular activities and those of interest were then fractionated using a µBondapak C18 (Waters, MA, USA) column (0.78cm X 30cm). The column was equilibrated with buffer A (0.1% trifluoroacetic acid – TFA, in water) and the proteins were eluted with a linear gradient of buffer B (0.035% TFA in 66% acetonitrile) at a flow rate of 1.0ml/min. The elution profile was monitored at 280nm. The fractions from reverse-phase HPLC were screened for neuromuscular activities. Those of interest were then pooled, lyophilized and stored at -20°C.

Phospholipase A2 activity

PLA2 activity was measured using the assay previously described by Cho and Kezdy (7) and Holzer and Mackessy (20), modified for 96-well plates (3). The enzyme activity, expressed as the reaction initial velocity (Vo), was calculated based on the increase in absorbance after 20 min. Absorbances at 425nm were measured using a SpectraMax 340 multiwell plate reader (Molecular Devices, Sunnyvale, CA, USA).

Electrophoresis

Tricine-PAGE in a discontinuous gel and buffer system (45) was used to estimate the molecular mass of the proteins, in the presence or absence of dithiothreitol (DTT). Marker proteins were included in the runs and the gels were stained with coomassie blue.

N-terminal sequencing

Direct sequencing of the N-terminal was done with reduced and carboxymethylated protein, using a Procise protein sequencing system (Applied Biosystems, CA, USA). Phenylthiohydantoin amino acids were identified by comparing their retention times with those of 20 phenylthiohydatoin amino acid standards.

Chick biventer cervicis (CBC) nerve-muscle preparation

A protocol (n° 431-1) according to the Ethical Principles for Animal Research, established by the Brazilian College for Animal Experimentation (COBEA) and approved by the Institutional Committee for Ethics in Animal Research (State University of Campinas – UNICAMP), was used. The biventer cervicis was removed from chicks (which had been killed by exposure to halothane) as described by Ginsborg and Warriner (16) and mounted under a tension of 0.5g in a 5ml organ bath containing aerated (95% O2, 5% CO2) Krebs solution (pH 7.5, 37°C) of the following composition (in mM): NaCl, 118.6; KCl, 4.69; CaCl2, 1.88; KH2PO4, 1.17; MgSO4, 1.17; NaHCO3, 25.0; and glucose, 11.65. Indirect stimulation (0.1Hz, 0.2ms, 6-7V) from a Grass S4 stimulator (Grass Instruments, Quincy, MA, USA) was used; muscle contractions and contractures were recorded via a force-displacement transducer (BG 25 GM, Kulite Semiconductor Products, Inc., Leonia, NJ, USA) coupled to a Gould RS 3400 recorder (Gould Inc., Cleveland, OH, USA). The preparations were allowed to stabilize for at least 15 min before the addition of fractions (10µg/ml). Contractures to exogenously applied submaximal concentrations of acetylcholine (110µM) and KCl (13.4mM) were obtained in the absence of nerve stimulation prior to the addition of toxins and at the end of the experiment in order to test for the presence of neurotoxic and myotoxic activities (18).

Electrophysiological procedure

Preparation: Left hemidiaphragm of mouse was prepared as previously described by Re et al. (37, 38). Briefly, Charles River male mice, 30-40 days old, were killed and the left hemidiaphragm was dissected together with a short length of phrenic nerve. The preparation was bathed in Krebs' solution of the following composition (mM): NaCl (133), KCl (4.7), MgCl2 (1.2), CaCl2 (7.2), NaH2PO4 (1.3), NaHCO3 (16.3), Glucose (7.8), pH 7.4, gassed with 95% O2-5% CO2 and kept at room temperature (18-22°C). Concentrations of MgCl2 (5 to 15mM) and CaCl2 (0.9 to 2mM) were adjusted in order to abolish the twitch of the muscle fiber.

The muscle was pinned on Sylgard resin, and placed on the stage of a Leitz inverted microscope. End-plates were visible by transillumination of the preparation using an optic fiber system. The preparation was equilibrated in saline for 30 minutes before starting the experiments.

End-plate signals: Spontaneous and evoked end-plate currents were recorded using a focal extracellular pipette pressed against the edge of an end-plate. Drummond 100µl measuring pipettes of soft glass (1.4mm) were pulled with a Kopf 700C Puller, which had a final tip diameter ranging from 3 to 15µm and was fire polished with a Narishighe MF83 Microforge. After filling with physiological solution, the electrode was connected to a List LM EPC7 current to voltage converter. Pipette resistances were of 100-300KW, and seal resistances, measured after pressing the pipette against the sarcolemma, ranged between 300-600KW. The loose patch clamp method (47) enables a good control of the series resistance all over the experiment (40). Furthermore, the voltage of the muscle fiber is well monitored using the same technique and virtually clamped at the resting value. Indirect stimulation of the muscle was achieved by means of a suction electrode. Supramaximal square wave pulses of 0.1ms duration at 2Hz were applied via a DA analogic output of a PCL 818 card (Advantech). The signals were visualized on a Tektronix 5113 dual-beam storage oscilloscope and fed to the input stage of the PCL 818 analogue-to-digital converter mounted on a computer system (PC IBM) enabling a fully automated analysis of the data (39). The decay phase of the miniature end-plate currents (mepc's) was analyzed to calculate the decay time constant. The elaboration was carried out on the mepc decay part that fell within 10-90% of its peak amplitude. The function used was:

where It is the current at time t; Io is the current at time zero, i.e. the peak current; and t is the decay time constant. Marquardt's least-squares method was used for the fitting.

The parameters were obtained using the protocol previously described by Re et al. (38). The technique led to automatic evaluation of the mean t value of the mepc's decay, the mean peak value of the miniature events (mepc), the spontaneous release frequency (f), and the mean epc's peak value (epc). The resting membrane potential (RMP) was measured using conventional intracellular microelectrodes (3M KCl) connected to aP16 differential amplifier (GRASS).

Statistical analysis

Each experiment was repeated at least three times. Results were expressed as mean ± standard error of mean (S.E.M.). Student's t-test was used for statistical analysis of the data, and values of p<0.05 indicated significance.

 

RESULTS

Bothrops neuwiedi pauloensis (BNP) venom was initially separated into 8 fractions by molecular exclusion (Figure 1A). Since the venom contains PLA2 activity (12.7nmol/min/mg), this enzyme was assayed along the venom elution profile. Only fractions 2 and 3, corresponding to the second and third peaks, had PLA2 activity: 25.8 and 48.2nmol/min/mg, respectively.

 

 

In indirectly stimulated CBC preparations, only fraction 3, corresponding to the third peak, produced complete blockade without significantly inhibiting the responses to ACh and KCl. At 10µg/ml, fraction 3 produced complete and irreversible neuromuscular blockade in 70±6 min at 37°C (n=4) (not shown). Low temperature (20-24°C) abolished the neuromuscular action of this fraction (n = 3) (not shown).

After repurification of fraction 3 (Figure 1B), only fractions corresponding to peak c (5-7% of venom protein), namely NeuTX-I, and peak b (3.5% of venom protein), namely NeuTX-II, induced neuromuscular blockade in CBC preparation. Tricine SDS-PAGE in the presence or absence of dithiothreitol showed that NeuTX-I and NeuTX-II had a molecular mass of ~14 and ~28kDa, respectively (Figure 1B, inset). NeuTX-I (10mg/ml) produced complete neuromuscular blockade up to 80 min (n=3), without inhibiting the responses to ACh and KCl (Figures 2A, B and D), whereas the response to KCl were partially inhibited after incubation with NeuTX-II (10 µg/ml) (Figures 2A, C and D).

 

 

The N-terminal sequences were determined up to the 36th for NeuTX-I, and up to the 41st for NeuTX-II amino acid residues (Figures 3 and 4).

 

 

 

 

To better clarify the possible molecular event involved in the NeuTX-I (the only toxin that induced complete neuromuscular blockade without inhibiting ACh and KCl-induced contracture) action, we studied the effects of the toxin (5, 10 and 50µg/ml) on mouse neuromuscular junction using the loose patch clamp technique (LPC). The results obtained were summarized in Table 1. The toxin induced an increase in the amplitude and frequency of the spontaneous release. Giant mepc's were frequently observed at NeuTX-I concentration of 10µg/ml (Figure 5). After this apparent facilitation, a complete block of the evoked release was always observed (Figures 6 a, b, c). Usually, the recovery of the evoked signals was incomplete after the final wash out. However, the block was overcome by adding calcium to the physiological solution (Figures 6 d, e).

 

 

 

 

 





 

During treatments with NeuTX-I, resting membrane potential values were not different from those obtained during control (toxin-free medium) experiments.

 

DISCUSSION

Although neurotoxicity has been demonstrated in vitro (4, 5, 9, 10, 12, 44, 46, 53) and in vivo (9, 53) for various Bothrops venoms, there is no conclusive evidence for such an effect after snakebite in humans. In vitro, the neurotoxicity of BNP venom is mainly presynaptic (4, 5, 12, 44, 53), although its potency varies from sample to sample (5).

Presynaptic inhibition is conveniently studied using dissected BCP preparation. A pure presynaptically active neurotoxin would abolish nerve-evoked twitches, without affecting responses to cholinoceptor agonists or the responses to direct muscle stimulation, but would not affect the responses to elevated K+ concentration (18). As a pure presynaptically neurotoxin, NeuTX-I induced complete neuromuscular blockade without inhibiting the responses to ACh and KCl. Consequently, its effects were studied using loose patch clamp technique on a mammalian neuromuscular junction. The electrophysiological data were indicative of a pure presynaptic effect. After an initial facilitation leading to depletion of ACh release, a complete calcium-dependent blockade was observed. The presynaptic action is confirmed by the constancy of the mepc's decay time, i.e. the rate constant of the receptor-ion channel complex conformational change, reflecting the closing of the ACh-sensitive channels (24, 29) at the postsynaptic sites.

In general, snake venoms contain a mixture of toxins active at prejunctional and postjunctional sites, as well as myotoxic components. Therefore, probably more than one component is capable of contributing to the neuromuscular action produced by the venom. Myotoxic components reduce the response of biventer cervicis muscle to exposure to elevated K+ concentration and/or initiate contractures in the muscle (18). These effects were produced by BNP venom (4) and NeuTX-II.

In previous reports, the neuromuscular blocking effect of BNP venom in BCP and MPND was temperature and Ca2+-dependent and this fact also indicated that enzymatic activity is necessary for neuromuscular action (4, 12). The neuromuscular blocking effect of the fraction corresponding to peak 3, from the molecular exclusion step, which showed PLA2 activity and revealed NeuTX-I and NeuTX-II after reverse-phase HPLC, was temperature-dependent, indicating that its neurotoxicity may require enzymatic activity, as suggested for the venom (4).

This is the first report of purification and N-terminal sequence of presynaptic PLA2 toxins from Bothrops venom. Several snake presynaptic PLA2, which produce the same pharmacological action of NeuTX-I in CBC at low concentrations (<10µg of toxin/ml), have been described, such as the presynaptic PLA2 caudoxin (30) from the venom of Bitis caudalis, which shares 54% homology with NeuTX-I. On the other hand, NeuTX-II shares 62% homology with the basic component of crotoxin, a potent neurotoxin from the venom of the South American rattlesnake Crotalus durissus terrificus. Crotoxin is a b-neurotoxin consisting of a heterodimer of a non-toxic, non-enzymatic acidic protein, named crotapotin, and a basic Asp-49 protein with PLA2 activity. The PLA2 is a single polypeptide chain of 123 amino acids with considerable similarity to other PLA2, while crotapotin consists of three polypeptides linked by several disulfide bridges (1).

A recent comparative study of the pharmacological activities of B. insularis, B. neuwiedi and C. d. terrificus in chick neuromuscular preparations (44) indicated that B. neuwiedi and B. insularis venoms may contain components that act presynaptically at the skeletal neuromuscular junction in a manner similar to C. d. terrificus venom and its main toxin, crotoxin. These conclusions were based on several evidences, such as the blockade of twitch-tension by B. neuwiedi and B. insularis venoms without affecting the response to the cholinoceptor agonist, thus suggesting a predominant presynaptic action. These authors also pointed out the persistence of KCl-induced contractures after neuromuscular blockade and the fact that at low concentrations both venoms were incapable of increasing creatine kinase activity.

The initial work on the neuromuscular blocking action of bothropic venoms by Rodrigues-Simioni et al. (43) led to the discovery of bothropstoxin-I (21), a myotoxin that has since been widely studied (19, 34, 35). The presence of a presynaptic PLA2 in B. n. pauloensis venom was expected, since several reports had already indicated that this venom had presynaptic neurotoxicity (4, 5, 12, 44, 53).

The fact that NeuTX-I has Gln-4 (Q-4), Phe-5 (F-5) and Tyr-28 (Y-28), and that NeuTX-II has Phe-5 (F-5) and Tyr-28 (Y-28), amino acid residues conserved in all Asp-49 (D-49) PLA2 variants purified so far, strongly suggests that both toxins are Asp-49 PLA2. The inactive or little catalytically active Lys-49 (K-49) PLA2 toxins have Leu-5 (L-5) for Phe-5 (F-5) and Asn-28 (N-28) for Tyr-28 (Y-28). The presence of Asp-49 is essential for effective hydrolysis of phospholipids. Besides Asp-49, the presence of Tyr-28, Gly-30 (G-30) and Gly-32 (G-32) is involved in the catalysis (50). NeuTX-I and NeuTX-II have Gly-30 and Gly-32, but Lys-49 toxins such as BnSP-7, a myotoxic PLA2 from B. n. pauloensis venom (13, 32, 46), besides bothropstoxin-I, piratoxins, Basp-II and Bneu, have Leu-32 (L-32) for Gly-32. In addition, the fraction that originated NeuTX-I and NeuTX-II, third peak from HPLC molecular exclusion elution profile, had PLA2 activity and its blocking action was temperature-dependent. Loose patch clamp confirmed the calcium-dependent blockade produced by NeuTX-I. All these findings together suggest that enzymatic activity is required for the pharmacological effects observed. Moreover, NeuTX-I and NeuTX-II may be the main components responsible for the neuromuscular blocking action of BNP venom. Based on our findings, the new toxins, NeuTX-I and NeuTX-II probably belong to two classes of PLA2 toxins: (1) group II, which include those toxins isolated from Viperinae and Crotalinae snake venoms; (2) b-neurotoxins group, which include presynaptic neurotoxic PLA2 toxins.

Although the neurotoxic action of Bothrops venoms is not a clinical problem, an understanding of the effects of other species may provide insights into a variety of physiological processes. Snake presynaptic neurotoxins with PLA2 activity affect the release of ACh and block the neurotransmission in an unknown way. Once their mechanism of action is firmly established, presynaptic PLA2 neurotoxins could be employed as tools to investigate specific aspects of neuroexocytosis. In addition, the isolation, identification, and pharmacological and biochemical characterization of PLA2 enzymes help to understand their structure-function relationships, which can be useful in developing prototypes of novel tools and pharmaceutical drugs (33).

 

ACKNOWLEDGEMENTS

The present work was supported by The State of São Paulo Research Foundation (FAPESP), National Council for Scientific and Technological Development (CNPq), The Coordination for the Improvement of Higher Education Personnel (CAPES), and Education and Research Foundation (FAEP-UNICAMP). The authors gratefully thank Gildo Bernardo Leite for technical assistance, and Butantan Institute for providing the venom sample.

 

REFERENCES

1 AIRD SD., KAISER II., LEWIS RV., KRUGGEL WG. A complete amino acid sequence for the basic subunit of crotoxin. Arch. Biochem. Biophys., 1986, 249, 296-300.        [ Links ]

2 AIRD SD., KRUGGEL WG., KAISER II. Amino acid sequence of the basic subunit of Mojave toxin from the venom of the Mojave rattlesnake (Crotalus s. scutulatus). Toxicon, 1990, 28, 669-73.        [ Links ]

3 BEGHINI DG., TOYAMA MH., HYSLOP S., SODEK L., NOVELLO JC., MARANGONI S. Enzymatic characterization of a novel phospholipase A2 from Crotalus durissus cascavella rattlesnake (maracambóia) venom. J. Protein Chem., 2000, 19, 603-7.        [ Links ]

4 BORJA-OLIVEIRA CR., DURIGON AM., VALLIN ACC., TOYAMA MH., SOUCCAR C., MARANGONI S., RODRIGUES-SIMIONI L. The pharmacological effects of Bothrops neuwiedi pauloensis (jararaca-pintada) snake venom on avian neuromuscular transmission. Braz. J. Med. Biol. Res., 2003, 36, 617-24.        [ Links ]

5 BORJA-OLIVEIRA CR., SOARES AM., ZAMUNER SR., HYSLOP S., GIGLIO JR., PRADO-FRANCESCHI J., RODRIGUES-SIMIONI L. Intraspecific variation in the neurotoxic and myotoxic activities of Bothrops neuwiedi snake venoms. J. Venom. Anim. Toxins, 2002, 8, 88-101.        [ Links ]

6 BUCARETCHI F., HERRERA SRF., HYSLOP S., BARACAT ECE., VIEIRA RJ. Snakebites by Bothrops spp in children in Campinas, São Paulo, Brazil. Rev. Inst. Med. Trop. São Paulo, 2001, 43, 329-33.        [ Links ]

7 CHO W., KEZDY FJ. Chromogenic substrate and assay of phospholipase A2. Meth. Enzymol., 1991, 197, 75-9.        [ Links ]

8 CINTRA AC., MARANGONI S., OLIVEIRA B., GIGLIO JR. Bothropstoxin-I: amino acid sequence and function. J. Protein Chem., 1993, 12, 57-64.        [ Links ]

9 COGO JC., PRADO-FRANCESCHI J., CRUZ-HÖFLING MA., CORRADO AP., RODRIGUES-SIMIONI L. Effects of Bothrops insularis on the mouse and chick nerve-muscle preparation. Toxicon, 1993, 31, 1237-47.        [ Links ]

10 COGO JC., PRADO-FRANCESCHI J., GIGLIO JR., CORRADO AP., CRUZ-HÖFLING MA., DONATO JL., LEITE GB., RODRIGUES-SIMIONI L. An unusual presynaptic action of Bothrops insularis snake venom mediated by phospholipase A2 fraction. Toxicon, 1998, 36, 1323-32.        [ Links ]

11 DE SOUSA MV., MORHY L., ARNI RK., WARD RJ., GUTIÉRREZ JM. AMino acid sequence of a myotoxic Lys-49-phospholipase A2 homologue from the venom of Cerrophidion (Bothrops) godmani. Biochim. Biophys. Acta, 1998, 1384, 204-8.        [ Links ]

12 DURIGON AM., BORJA-OLIVEIRA CR., DAL BELO CA., OSHIMA-FRANCO Y., COGO JC., LAPA AJ., SOUCCAR C., RODRIGUES-SIMIONI L. Neuromuscular activity of Bothrops neuwiedi pauloensis snake venom in mouse nerve-muscle preparations. J. Venom. Anim. Toxins incl. Trop. Dis., 2005, 11, 22-33.        [ Links ]

13 FONTES MR., SOARES AM., RODRIGUES VM., FERNANDES AC., DA SILVA RJ, GIGLIO JR. Crystallization and preliminary X-ray diffraction analysis of a myotoxic phospholipase A(2) homologue from Bothrops neuwiedi pauloensis venom. Biochim. Biophys. Acta, 1999, 1432, 393-5.        [ Links ]

14 FRANCIS B., GUTIERREZ JM., LOMONTE B., KAISER II. Myotoxin II from Bothrops asper (Terciopelo) venom is a lysine-49 phospholipase A2. Arch. Biochem. Biophys., 1991, 284, 352-9.        [ Links ]

15 GEOGHEGAN P., ANGULO Y., CANGELOSI A., DIAZ M., LOMONTE B. Characterization of a basic phospholipase A2-homologue myotoxin isolated from the venom of the snake Bothrops neuwiedii (yarara chica) from Argentina. Toxicon, 1999, 37, 1735-46.        [ Links ]

16 GINSBORG BL., WARRINER J. The isolated chick biventer cervicis nerve-muscle preparation. Brit. J. Pharmacol., 1960, 15: 410-1.        [ Links ]

17 HALPERT J., EAKER D. Amino acid sequence of a presynaptic neurotoxin from the venom of Notechis scutatus scutatus (Australian tiger snake). J. Biol. Chem., 1975, 250, 6990-7.        [ Links ]

18 HARVEY AL., BARFARAZ A., THOMPSON E., FAIZ A., PRESTON S., HARRIS JB. Screening of snake venoms for neurotoxic and myotoxic effects using simple in vitro preparations from rodents and chicks. Toxicon, 1994, 32, 257-65.        [ Links ]

19 HELUANY NF., HOMSI-BRANDEBURGO MI., GIGLIO JR., PRADO-FRANCESCHI J., RODRIGUES-SIMIONI L. Effects induced by bothropstoxin, a component from Bothrops jararacussu snake venom, on mouse and chick muscle preparations. Toxicon, 1992, 30, 1203-10.        [ Links ]

20 HOLZER M., MACKESSY SP. An aqueous endpoint assay of snake venom phospholipase A2. Toxicon, 1995, 35, 1149-55.        [ Links ]

21 HOMSI-BRANDEBURGO MI., QUEIROZ LS., SANTO-NETO H., RODRIGUES-SIMIONI L., GIGLIO JR. Fractionation of Bothrops jararacussu snake venom: partial chemical characterization and biological activity of bothropstoxin. Toxicon, 1988, 26, 615-27.        [ Links ]

22 JOHNSON EK., OWNBY CL. Isolation of a myotoxin from the venom of Agkistrodon contortrix laticinctus (broad-banded copperhead) and pathogenesis of myonecrosis induced by it in mice. Toxicon, 1993, 31, 243-55.        [ Links ]

23 KAISER II., GUTIERREZ JM., PLUMMER D., AIRD SD., ODELL GV. The amino acid sequence of a myotoxic phospholipase from the venom of Bothrops asper. Arch. Biochem. Biophys., 1990, 278, 319-25.        [ Links ]

24 KATZ B., MILEDI R.. The binding of acetylcholine to receptors and its removal from the synaptic cleft. J. Physiol., 1973, 231, 549-74.        [ Links ]

25 KINI RM. Phospholipase A2 – A complex multifunctional protein puzzle. In: Kini RM. Ed., Venom phosholipase A2 enzymes. Structure, function and mechanism. New York: John Wiley & Sons Inc Chichester, 1997, 1-28.        [ Links ]

26 KONDO K., NARITA K., LEE CY. Amino acid sequences of the two polypeptide chains in beta1-bungarotoxin from the venom of Bungarus multicinctus. J. Biochem., 1978, 83, 101-15.        [ Links ]

27 KONDO K., TODA H., NARITA K., LEE CY. Amino acid sequence of b2-bungarotoxin from Bungarus multicinctus venom: the amino acid substitutions in the B chains. J. Biochem., 1982, 91, 1519-30.        [ Links ]

28 KONDO K., ZHANG J., XU K., KAGAMIYAMA H. Amino acid sequence of a presynaptic neurotoxin, agkistrodotoxin, from the venom of Agkistrodon halys pallas. J. Biochem., 1989, 105, 196-203.        [ Links ]

29 KORDAS M. On the role of junctional cholinesterase in determining the time course of the end-plate current. J. Physiol., 1977, 270, 133-50.        [ Links ]

30 LEE CY., HO CL., BOTES DP. Site of action of caudoxin, a neurotoxic phospholipase A2 from the horned puff adder (Bitis caudalis) venom. Toxicon, 1982, 20, 637-47.        [ Links ]

31 LIND P., EAKER D. Amino-acid sequence of the alpha-subunit of taipoxin, an extremely potent presynaptic neurotoxin from the Australian snake taipan (Oxyuranus s. scutellatus). European J. Biochem., 1982, 124, 441-7.        [ Links ]

32 MAGRO AJ., SOARES AM., GIGLIO JR., FONTES MR. Crystal structures of BnSP-7 and BnSP-6, two Lys49 phospholipases A2: quartenary structure and inhibition mechanism insights. Biochem. Biophys. Res. Commun., 2003, 311, 713-20.        [ Links ]

33 MONTECUCCO C., ROSSETTO O. How do presynaptic PLA2 neurotoxins block nerve terminals? Trends Biochem. Sciences, 2000, 25, 266-70.        [ Links ]

34 OSHIMA-FRANCO Y., HYSLOP S., CINTRA AC., GIGLIO JR., DA CRUZ-HOFLING MA., RODRIGUES-SIMIONI L. Neutralizing capacity of commercial bothropic antivenom against Bothrops jararacussu venom and bothropstoxin-I. Muscle Nerve, 2000, 23, 1832-9.        [ Links ]

35 OSHIMA-FRANCO Y., LEITE GB., SILVA GH., CARDOSO DF., HYSLOP S., GIGLIO JR., DA CRUZ-HOFLING MA., RODRIGUES-SIMIONI L. Neutralization of the pharmacological effects of bothropstoxin-I from Bothrops jararacussu (jararacuçu) venom by crotoxin antiserum and heparin. Toxicon, 2001, 39, 1477-85.        [ Links ]

36 PEREIRA MF., NOVELLO JC., CINTRA AC., GIGLIO JR., LANDUCCI ET., OLIVEIRA B., MARANGONI S. The amino acid sequence of bothropstoxin-II, an Asp-49 myotoxin from Bothrops jararacussu (jararacuçu) venom with low phospholipase A2 activity. J. Protein Chem., 1998, 17, 381-6.        [ Links ]

37 RE L., BAROCCI S., CAPITANI C., VIVANI C., RICCI M., RINALDI L., PAOLUCCI G., SCARPANTONIO A., LEON-FERNANDEZ OS., MORALES MA. Effects of some natural extracts on the acetylcholine release at the mouse neuromuscular junction. Pharmacol. Res., 1999, 39, 239-45.        [ Links ]

38 RE L., COLA V., FULGENZI G., MARINELLI F., CONCETTONI C., ROSSINI L. Postsynaptic effects of methoctramine at the mouse neuromuscular junction. Neuroscience, 1993, 57, 451-7.        [ Links ]

39 RE L., GIUSTI P., CONCETTONI C., DI SARRA B. Computerized estimation of spontaneous and evoked acetylcholine release at the neuromuscular junction. J. Pharmacol. Meth., 1989, 22, 233-42.        [ Links ]

40 RE L., MORETTI V., ROSSINI L., GIUSTI P. Sodium-activated potassium current in mouse diaphragm. FEBS Lett., 1990, 270, 195-7.        [ Links ]

41 RIBEIRO LA., ALBUQUERQUE MJ., PIRES DE CAMPOS VAF., KATZ G., TAKAOKAM NY., LEBRÃO ML., JORGE MT. ÓBitos por serpentes peçonhentas no Estado de São Paulo: avaliação de 43 casos, 1988/98. Rev. Assoc. Méd. Bras., 1998, 44, 312-8.        [ Links ]

42 RITONJA A., GUBENSEK F. Ammodytoxin A, a highly lethal phospholipase A2 from Vipera ammodytes ammodytes venom. Biochim. Biophys. Acta, 1985, 828, 306-12.        [ Links ]

43 RODRIGUES-SIMIONI L., BORGESE N., CECCARELLI B. The effects of Bothrops jararacussu venom and its components on frog nerve-muscle preparation. Neuroscience, 1983, 10, 475-89.        [ Links ]

44 RODRIGUES-SIMIONI L., ZAMUNER SR., COGO JC., BORJA-OLIVEIRA CR., PRADO-FRANCESCHI J., CRUZ-HOFLING MA., CORRADO AP. Pharmacological evidence for a presynaptic action of venoms from Bothrops insularis (jararaca ilhoa) and Bothrops neuwiedi (jararaca pintada). Toxicon, 2004, 43, 633-8.        [ Links ]

45 SCHAGGER H., VON JAGOW G. Tricine-sodium dodecyl sulfate-polyacrylamide gel electrophoresis for the separation of proteins in the range from 1 to 100kDa. Anal. Biochem., 1987, 166, 368-79.        [ Links ]

46 SOARES AM., GUERRA-SÁ R., BORJA-OLIVEIRA CR., RODRIGUES VM., RODRIGUES-SIMIONI L., RODRIGUES V., FONTES MRM., LOMONTE B., GUTIÉRREZ JM., GIGLIO JR. STRUCTURAl and functional characterization of BnSP-7, a Lys49 myotoxic phospholipase A2 homologue from Bothrops neuwiedi venom. Arch. Biochem. Biophys., 2000, 378, 201-9.        [ Links ]

47 STÜHMER W., ROBERTS WM., ALMERS W. The loose patch clamp. In: SAKMANN B AND NEHER E, Eds. Single Channel Recording. Plenum Press, New York; 1983, 123.        [ Links ]

48 TOYAMA MH., SOARES AM., WEN-HWA L., POLIKARPOV I., GIGLIO JR., MARANGONI S. Amino acid sequence of piratoxin-II, a myotoxic lys49 phospholipase A2 homologue from Bothrops pirajai venom. Biochimie, 2000, 82, 245-50.        [ Links ]

49 TSAI IH., LU PJ., WANG YM., HO CL., LIAW LL. Molecular cloning and characterization of a neurotoxic phospholipase A2 from the venom of Taiwan habu (Trimeresurus mucrosquamatus). Biochem. J., 1995, 311, 895-900.        [ Links ]

50 VAN DEN BERGH CJ., SLOTBOOM AJ., VERHEIJ HM., DE HAAS GH. The role of aspartic acid-49 in the active site of phospholipase A2. A site-specific mutagenesis study of porcine pancreatic phospholipase A2 and the rationale of the enzymatic activity of Lys-49 phospholipase A2 from Agkistrodon piscivorus piscivorus venom. European J. Biochem., 1988, 176, 353-7.        [ Links ]

51 VAN DEENEN LL., DE HAAS GH. The substrate specificity of phospholipases A2. Biochim. Biophys. Acta, 1963, 70, 538-53.        [ Links ]

52 VILJOEN CC., BOTES DP., KRUGER H. Isolation and amino acid sequence of caudoxin, a presynaptic acting toxic phospholipase A2 from the venom of the horned puff adder (Bitis caudalis). Toxicon, 1982, 20, 715-37.        [ Links ]

53 ZAMUNER SR., PRADO-FRANCESCHI J., RODRIGUES-SIMIONI L. The screening of Bothrops venoms for neurotoxic activity using the chick biventer cervicis preparation. Toxicon, 1996, 34, 314-5.        [ Links ]

 

 

Correspondence to:
Léa Rodrigues-Simioni
Departamento de Farmacologia
Faculdade de Ciências Médicas
Universidade Estadual de Campinas (UNICAMP)
Caixa Postal 6111
13083-970, Campinas, SP, Brasil
Phone: 55-19-3788-9534
Fax: 55-19-3289-2968
Email: simioni@unicamp.br

Received: April 12, 2006
Accepted: June 7, 2006
Abstract published online: August 31, 2006
Full paper published online: February 28, 2007
Conflicts of interest: There is no conflict.