Conomarphin-Mr1 |
DWEYHAHPKONSfWT |
Conomarphin |
No data |
[12Dutertre S, Jin A-h, Kaas Q, Jones A, Alewood PF, Lewis RJ. Deep venomics reveals the mechanism for expanded peptide diversity in cone snail venom. Mol Cell Proteomics. 2013 Feb;12(2):312-29., 17Han Y, Huang F, Jiang H, Liu L, Wang Q, Wang Y, Shao X, Chi C, Du W, Wang C. Purification and structural characterization of a D-amino acid-containing conopeptide, conomarphin, from Conus marmoreus. FEBS J. 2008 May;275(9):1976-87.] |
Conomarphin-Mr2 |
DWVNHAHOQONSIWS |
Conomarphin |
No data |
[12Dutertre S, Jin A-h, Kaas Q, Jones A, Alewood PF, Lewis RJ. Deep venomics reveals the mechanism for expanded peptide diversity in cone snail venom. Mol Cell Proteomics. 2013 Feb;12(2):312-29.] |
Conomarphin-14 |
DWEYHAHPKONSfW |
Conomarphin |
No data |
[12Dutertre S, Jin A-h, Kaas Q, Jones A, Alewood PF, Lewis RJ. Deep venomics reveals the mechanism for expanded peptide diversity in cone snail venom. Mol Cell Proteomics. 2013 Feb;12(2):312-29., 18Zhang L, Shao X, Chi C, Wang C. Two short D-Phe-containing cysteine-free conopeptides from Conus marmoreus. Peptides. 2010 Jan;31(1):177-9.] |
Conomarphin-8 |
HPKONSfW |
Conomarphin |
No data |
[12Dutertre S, Jin A-h, Kaas Q, Jones A, Alewood PF, Lewis RJ. Deep venomics reveals the mechanism for expanded peptide diversity in cone snail venom. Mol Cell Proteomics. 2013 Feb;12(2):312-29., 18Zhang L, Shao X, Chi C, Wang C. Two short D-Phe-containing cysteine-free conopeptides from Conus marmoreus. Peptides. 2010 Jan;31(1):177-9.] |
Contryphan-M |
NγSγCPwHPWC# |
Contryphan |
No data |
[12Dutertre S, Jin A-h, Kaas Q, Jones A, Alewood PF, Lewis RJ. Deep venomics reveals the mechanism for expanded peptide diversity in cone snail venom. Mol Cell Proteomics. 2013 Feb;12(2):312-29.,19Hansson K, Ma X, Eliasson L, Czerwiec E, Furie B, Furie BC, Rorsman P, Stenflo J. The first gamma-carboxyglutamic acid-containing contryphan. A selective L-type calcium ion channel blocker isolated from the venom of Conus marmoreus. J Biol Chem. 2004 Jul 30;279(31):32453-63.] |
contryphan-M2 |
ESECPWHPWC# |
Contryphan |
No data |
[12Dutertre S, Jin A-h, Kaas Q, Jones A, Alewood PF, Lewis RJ. Deep venomics reveals the mechanism for expanded peptide diversity in cone snail venom. Mol Cell Proteomics. 2013 Feb;12(2):312-29.] |
Mr034 |
DCCPVAGMPLWMQPLLWMTSFVIGTSSSNE |
Unclassified |
No data |
[12Dutertre S, Jin A-h, Kaas Q, Jones A, Alewood PF, Lewis RJ. Deep venomics reveals the mechanism for expanded peptide diversity in cone snail venom. Mol Cell Proteomics. 2013 Feb;12(2):312-29.] |
Mr035 |
LVVGDQLCYRVLIKCLMNK |
Unclassified |
No data |
[12Dutertre S, Jin A-h, Kaas Q, Jones A, Alewood PF, Lewis RJ. Deep venomics reveals the mechanism for expanded peptide diversity in cone snail venom. Mol Cell Proteomics. 2013 Feb;12(2):312-29.] |
Mr036 |
TLQNASEQTLLPRLGIVLRV |
Unclassified |
No data |
[12Dutertre S, Jin A-h, Kaas Q, Jones A, Alewood PF, Lewis RJ. Deep venomics reveals the mechanism for expanded peptide diversity in cone snail venom. Mol Cell Proteomics. 2013 Feb;12(2):312-29.] |
Mr038 |
NγFLTHTFS(Btr)HPTWCPWC# |
Unclassified |
No data |
[12Dutertre S, Jin A-h, Kaas Q, Jones A, Alewood PF, Lewis RJ. Deep venomics reveals the mechanism for expanded peptide diversity in cone snail venom. Mol Cell Proteomics. 2013 Feb;12(2):312-29.] |
Mr080 |
STIPSLGSEWDDGW |
Unclassified |
No data |
[12Dutertre S, Jin A-h, Kaas Q, Jones A, Alewood PF, Lewis RJ. Deep venomics reveals the mechanism for expanded peptide diversity in cone snail venom. Mol Cell Proteomics. 2013 Feb;12(2):312-29.] |
Mr081 |
TLQMLGTNAAAQAGNCAASGMMGGKGK |
Unclassified |
No data |
[12Dutertre S, Jin A-h, Kaas Q, Jones A, Alewood PF, Lewis RJ. Deep venomics reveals the mechanism for expanded peptide diversity in cone snail venom. Mol Cell Proteomics. 2013 Feb;12(2):312-29.] |
Mr082 |
TLQMLRTNAAAQAGNCAASGMMGGKGK |
Unclassified |
No data |
[12Dutertre S, Jin A-h, Kaas Q, Jones A, Alewood PF, Lewis RJ. Deep venomics reveals the mechanism for expanded peptide diversity in cone snail venom. Mol Cell Proteomics. 2013 Feb;12(2):312-29.] |
Mr083 |
QMLRTNAAAQAGNCAASGMMGGKENDLR |
Unclassified |
No data |
[12Dutertre S, Jin A-h, Kaas Q, Jones A, Alewood PF, Lewis RJ. Deep venomics reveals the mechanism for expanded peptide diversity in cone snail venom. Mol Cell Proteomics. 2013 Feb;12(2):312-29.] |
Mr086 |
TLTNASEQTLLPRLGIVLRVG |
Unclassified |
No data |
[12Dutertre S, Jin A-h, Kaas Q, Jones A, Alewood PF, Lewis RJ. Deep venomics reveals the mechanism for expanded peptide diversity in cone snail venom. Mol Cell Proteomics. 2013 Feb;12(2):312-29.] |
Mr087 |
TLQKLLNKTLLPNSATVL |
Unclassified |
No data |
[12Dutertre S, Jin A-h, Kaas Q, Jones A, Alewood PF, Lewis RJ. Deep venomics reveals the mechanism for expanded peptide diversity in cone snail venom. Mol Cell Proteomics. 2013 Feb;12(2):312-29.] |
Mr088 |
TLTKAFEQTLLPNSATVL |
Unclassified |
No data |
[12Dutertre S, Jin A-h, Kaas Q, Jones A, Alewood PF, Lewis RJ. Deep venomics reveals the mechanism for expanded peptide diversity in cone snail venom. Mol Cell Proteomics. 2013 Feb;12(2):312-29.] |
Mr103 |
GCGMMRVTVQQPLSPEALSWTPNCNVS |
Unclassified |
No data |
[12Dutertre S, Jin A-h, Kaas Q, Jones A, Alewood PF, Lewis RJ. Deep venomics reveals the mechanism for expanded peptide diversity in cone snail venom. Mol Cell Proteomics. 2013 Feb;12(2):312-29.] |
Mr105 |
AMVIDGQKLMHDCAIANDYIDDPWWTLNLGAFEEKRVYHSMLSELVFCLNAFLQ |
Unclassified |
No data |
[12Dutertre S, Jin A-h, Kaas Q, Jones A, Alewood PF, Lewis RJ. Deep venomics reveals the mechanism for expanded peptide diversity in cone snail venom. Mol Cell Proteomics. 2013 Feb;12(2):312-29.] |
Mr106 |
CIGSCDSTVWHRV |
Unclassified |
No data |
[12Dutertre S, Jin A-h, Kaas Q, Jones A, Alewood PF, Lewis RJ. Deep venomics reveals the mechanism for expanded peptide diversity in cone snail venom. Mol Cell Proteomics. 2013 Feb;12(2):312-29.] |
Mr107 |
DVKSIGSWDFTVWHRV |
Unclassified |
No data |
[12Dutertre S, Jin A-h, Kaas Q, Jones A, Alewood PF, Lewis RJ. Deep venomics reveals the mechanism for expanded peptide diversity in cone snail venom. Mol Cell Proteomics. 2013 Feb;12(2):312-29.] |
Mr-1/conomarphin-Mr3 |
DWEYHAHPKPNSFWT |
Conomarphin |
Unknown |
This work |
Mr-2 |
YPTRAYPSNKFG |
Unclassified |
Unknown |
This work |
Mr-3 |
NVIQAPAQSVAPPNTST |
Unclassified |
Unknown |
This work |
Mr-4 |
KENVLNKLKSK(L/I) |
Unclassified |
Unknown |
This work |
Mr-5 |
NAVAAAN(L/I)PG(L/I)V |
Unclassified |
Unknown |
This work |